We Are Solutions...On Demand

Youtube Facebook Twitter LinkedIn

Eosinophil Cationic Protein (ECP), Human

Sort By: All A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Item #: 342-50

Description

Synonyms:

ECP, Ribonuclease 3

Catalogue Number:

342-50

Storage:

-20 C

Molecular Weight:

18-22kDa (3 glycosolated forms exists)

Product Name:

Eosinophil Cationic Protein

UNSPSC code:

51131907

Form:

Liquid in ammonium acetate, sodium chloride

Protein Conc:

0.1 - 1.0 mg/mL (BCA)

Recertification:

1 year

Source:

Human Eosinophils

Preservatives:

0.2 NaCl

Appearance:

Clear, colorless liquid

Purity:

> 80% (SDS-PAGE)

Gene:

RNASE3

Price

Unit

Qty

$895.00

0.025mg

Details

Lee Biosolutions is the leading supplier of human Eosinophil Cationic Protein (ECP) for research and diagnostic manufacturing purposes.

Technical support, bulk quantities and aliquoting available, email Info@leebio.com for more details.

Sequence: RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Human Eosinophil degranulation in airway tissues is thought to make significant contributions to the pathogenesis of asthma, nasal polyposis, allergic rhinitis, and eosinophilic pneumonia.

It also alters pulmonary surfactant structure and function in asthma and the proteins are critical in the pathogenesis of tropical pulmonary eosinophilia (TPE).

Human Eosinophils are also associated with other diseases of the respiratory tract. Respiratory syncytial virus (RSV) is an important respiratory pathogens worldwide. Infection is often implicated in exacerbation of asthma in children

Questions

About A Product?

Click Here

Talk with our scientific experts today.

More