McAfee Secure sites help keep you safe from identity theft, credit card fraud, spyware, spam, viruses and online scams

Item#: 4353-Q01 Myeloperoxidase Human-( recombinant )


$350.00/10ug (Lead time required. Please check for availability.) Quantity

$550.00/25ug (Lead time required. Please check for availability.) Quantity


Product Info:

Print This Page (Macintosh users, select "Print" from your browser's "File" menu)

Product Name: Myeloperoxidase Human-( recombinant )
Cat. No: 4353-Q01
Form: 50mM Tris-HCL, 10mM reduced Glutathione, pH 8.0
Molecular Weight: 37.11
Source: Recombinant
Storage: Store at -80C.
Synonyms: r-hMPO

PROTEIN SEQUENCE: GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALA ISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS

Product manufactured by Abnova

MPO(NP_00241,646a.a-746a.a) partial recombinant protein with GST

GENE ONTOLOGY: GO: 0003682,
GO: 0004601, GO: 0005509, GO: 0005634,
GO: 0005764,GO: 0006916, GO: 0006952, GO: 0006979
GO: 0016491, GO: 0042744

Entrz GeneID: 4353
GenBank Accession NO: NM_000250
Omim + ID: 104300, 254600, 606989
Protein Accession NO: NP_000241
Length of Tag 334 aa with GST tag


INQUIRE ON Myeloperoxidase BULK QUANTITIES from 1-10mg single lot sizes

Myeloperoxidase (MPO) Products we offer:
4353-Q01 Myeloperoxidase Recombinant (r-hMPO) Human
426-10 MYELOPEROXIDASE ANTIGEN (MPO) Human Neutrophil
426-10LV MYELOPEROXIDASE ANTIGEN (MPO) Human Neutrophil
426-10AB Myeloperoxidase Isoform A+B Human Neutrophil
426-10C Myeloperoxidase Isoform C Human Neutrophil
CPX-80A Myeloperoxidase Polyclonal Antibody affinity purified Host Chicken
RPX-80A Myeloperoxidase Polyclonal antibody affinity purified (MPO) Host Rabbit
426-10MAB Monoclonal Myeloperoxidase


Human Myeloperoxidase,MPO research: Human Myeloperoxidase (MPO)antigen is a peroxidase enzyme most abundantly present in neutrophil granulocytes (a subtype of white blood cells). Human Myeloperoxidase(MPO) is a lysosomal protein stored in azurophilic granules of the neutrophil. Human Myeloperoxidase (MPO) has a heme pigment, which causes its green color in secretions rich in neutrophils.

Human Myeloperoxidase (MPO) deficiency is a common inherited disorder linked to increased susceptibility to infection and malignancy. Human Myeloperoxidase (MPO) enzyme is expressed in the azurophilic granules of neutrophils and in the lysosomes of monocytes. Its major role is to aid in microbial killing. Human Myeloperoxidase MPO deficiency can be divided into two subgroups: primary (congenital) and secondary (acquired). Primary Human Myeloperoxidase MPO deficiency has a genetic origin, present varying degree of severity in more than one family member, and involves both the neutrophil and monocyte lineages.Human Myeloperoxidase (human MPO) REF: http://dna.uta.fi/xml/idr/FF82.xml/Myeloperoxidase

Human Myeloperoxidase,MPO research: Usefulness of Baseline Plasma Myeloperoxidase Levels as an Independent Predictor of Myocardial Infarction at Two Years in Patients Presenting With Acute Coronary Syndrome.Human Myeloperoxidase,MPO Ref: The American Journal of Cardiology, Volume 99, Issue 10, 15 May 2007, Pages 1364-1368/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: The vinyl-sulfonium bond in human myeloperoxidase: Impact on compound I formation and reduction by halides and thiocyanate.Human Myeloperoxidase,MPO Ref: Biochemical and Biophysical Research Communications, Volume 356, Issue 2, 4 May 2007, Pages 450-456/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Myeloperoxidase as a marker of increasing systemic inflammation in smokers without severe airway symptoms.Human Myeloperoxidase,MPO Ref: Respiratory Medicine, Volume 101, Issue 5, May 2007, Pages 888-895/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Formulation of ELF magnetic fields’ effects on malondialdehyde level and myeloperoxidase activity in kidney using genetic programming.Human Myeloperoxidase,MPO Ref: Computer Methods and Programs in Biomedicine, Volume 86, Issue 1, April 2007, Pages 1-9/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Matrix metaloproteinase-9 (MMP-9) and myeloperoxidase (MPO) plasma levels, and coronary morphology in asymptomatic subjects, as diagnosed by 64-row multidetector computed tomography.Human Myeloperoxidase,MPO Ref: Journal of Nuclear Cardiology, Volume 14, Issue 2, April 2007, Page S89/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Inhibition of oxidation activity of myeloperoxidase (MPO) by propylthiouracil (PTU) and anti-MPO antibodies from patients with PTU-induced vasculitis.Human Myeloperoxidase,MPO Ref: Clinical Immunology, Volume 122, Issue 2, February 2007, Pages 187-193/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Appraisal of Myeloperoxidase for Evaluation of Patients With Suspected Acute Coronary Syndromes.Human Myeloperoxidase,MPO Ref:Journal of the American College of Cardiology, 4 May 2007/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Recombinant human erythropoietin decreases myeloperoxidase and caspase-3 activity and improves early functional results after spinal cord injury in rats.Human Myeloperoxidase, MPO Ref: Journal of Clinical Neuroscience, Volume 14, Issue 4, April 2007, Pages 364-368/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Metoprolol treatment decreases tissue myeloperoxidase activity after spinal cord injury in rats.Human Myeloperoxidase,MPO Ref: Journal of Clinical Neuroscience, Volume 14, Issue 2, February 2007, Pages 138-142/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Endothelial cell dysfunction and not blood rheology determines tissue myeloperoxidase activity after resuscitation from hemorrhagic shock.Human Myeloperoxidase,MPO Ref:
Journal of Surgical Research, Volume 137, Issue 2, February 2007, Page 336/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: The effect of primary percutaneous coronary intervention as compared to tenecteplase on myeloperoxidase, pregnancy-associated plasma protein A, soluble fibrin and D-dimer in acute myocardial infarction.Human Myeloperoxidase,MPO Ref:Thrombosis Research, Volume 119, Issue 4, 2007, Pages 415-421/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: The human myeloperoxidase gene is regulated by LXR and PPARα ligands.Human Myeloperoxidase,MPO Ref:
Biochemical and Biophysical Research Communications, Volume 349, Issue 2, 20 October 2006, Pages 846-854/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Plasma Myeloperoxidase Levels in Patients With Chronic Heart Failure.Human Myeloperoxidase,MPO Ref:
The American Journal of Cardiology, Volume 98, Issue 6, 15 September 2006, Pages 796-799/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Upregulation of myeloperoxidase in patients with opticospinal multiple sclerosis: Positive correlation with disease severity.Human Myeloperoxidase,MPO Ref: Journal of Neuroimmunology, Volume 178, Issues 1-2, September 2006, Pages 156-160/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Human Myeloperoxidase (MPO)Recommended article: Prognostic value of myeloperoxidase in patients with chest pain. Human Myeloperoxidase(MPO) Reference:Cleveland Clinic, Brennan, M.-L,Hazen, S. L. : MPO REF:New Eng. J. Med. 349: 1595-1604, 2003/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: (MPO)Myeloperoxidase Generates 5-Chlorouracil in Human Atherosclerotic Tissue. Human Myeloperoxidase(MPO)REF: J. Biol. Chem., Vol. 281, Issue 6, 3096-3104, February 10, 2006/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: myeloperoxidase (MPO) modifies in multiple ways amino acid residues in human serum albumin. Human Myeloperoxidase(MPO) REF: Free Radic Biol Med. 2006 Feb 1;40(3):516-25/mpo/Myeloperoxidase.

Human Myeloperoxidaes (MPO) research: Chronic Granulomatous Disease (CGD) and Complete Myeloperoxidase (MPO) Human Myeloperoxidase MPO REF: Clin. Chem., May 2007; 53: 890 - 896/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Increased concentrations of inflammatory biomarkers such as Human Myeloperoxidase (MPO)antigen, serum Amyloid A, CRP C-Reactive Protein in ACS (acute coronary syndrome) patients. Human Myeloperoxidase(MPO) REF: The National Academy of Clinical Biochemistry reports on Human Human Myeloperoxidase (MPO)antigen

Human Myeloperoxidase,MPO research: Reactions of Superoxide with Myeloperoxidase (MPO). Human Myeloperoxidase(MPO) REF: Biochemistry; 2007; 46(16) pp 4888 - 4897/mpo/Myeloperoxidase.

Human Myeloperoxidase,MPO research: Disruption of the aspartate to heme ester linkage in human myeloperoxidase (MPO).Human Myeloperoxidase(MPO) REF: J Biol Chem. 2007 Apr 16/mpo/Myeloperoxidase.

Human Myeloperoxidase,human MPO research: Activated neutrophils inhibit nucleotide excision repair in human pulmonary epithelial cells: role of myeloperoxidase. Human Myeloperoxidase(MPO) REF: Nejla Güngör, Roger W.L. Godschalk, Daniëlle M. Pachen, Frederik J. Van Schooten, and Ad M. Knaapen /mpo/Myeloperoxidase.

Human Myeloperoxidase,human MPO research: Serum Myeloperoxidase Levels Are Associated With the Future Risk of Coronary Artery Disease in Apparently Healthy Individuals: The EPIC-Norfolk Prospective Population Study.Human Myeloperoxidase,human MPO reference:
Journal of the American College of Cardiology,21 June 2007/human/myeloperoxidase

Human Myeloperoxidase,human MPO research: Prognostic Value and Echocardiographic Determinants of Plasma Myeloperoxidase Levels in Chronic Heart Failure.Human Myeloperoxidase,human MPO ref:
Journal of the American College of Cardiology, Volume 49, Issue 24, 19 June 2007, Pages 2364-2370/human/myeloperoxidase

Site Development and Maintenance provided by Creative Anvil, St. Louis Pay-Per-Click, and Web Design Firm