Item#: 4353-Q01 MYELOPEROXIDASE, Human (Recombinant)

Product Name: MYELOPEROXIDASE, Human (Recombinant)
Storage: Store at -80C.
Form: 50mM Tris-HCL, 10mM reduced Glutathione, pH 8.0
Molecular Weight: 37.11
Source: Recombinant
Cat. No: 4353-Q01
Synonyms: r-hMPO

** DISCONTINUED ITEM **


Print This Page

PROTEIN SEQUENCE: GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALA ISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS

Product manufactured by Abnova

MPO(NP_00241,646a.a-746a.a) partial recombinant protein with GST

GENE ONTOLOGY: GO: 0003682,
GO: 0004601, GO: 0005509, GO: 0005634,
GO: 0005764,GO: 0006916, GO: 0006952, GO: 0006979
GO: 0016491, GO: 0042744

Entrz GeneID: 4353
GenBank Accession NO: NM_000250
Omim + ID: 104300, 254600, 606989
Protein Accession NO: NP_000241
Length of Tag 334 aa with GST tag

INQUIRE ON Myeloperoxidase BULK QUANTITIES from 1-10mg single lot sizes

Myeloperoxidase (MPO) Products we offer:
426-10 Myeloperoxidase Antigen Liquid
426-10LV Myeloperoxidase Lyophilized
426-10AB Myeloperoxidase Isoform A+B
426-10A Myeloperoxidase Isoform A
426-10B Myeloperoxidase Isoform B
426-10C Myeloperoxidase Isoform C
CPX-80A Myeloperoxidase Polyclonal Antibody affinity purified Host Chicken
RPX-80A Myeloperoxidase Polyclonal antibody affinity purified Host Rabbit
426-10MAB Monoclonal Myeloperoxidase
4353-Q01 Myeloperoxidase Recombinant

Human Myeloperoxidase,MPO research: Human Myeloperoxidase (MPO)antigen is a peroxidase enzyme most abundantly present in neutrophil granulocytes (a subtype of white blood cells). Human Myeloperoxidase(MPO) is a lysosomal protein stored in azurophilic granules of the neutrophil. Human Myeloperoxidase (MPO) has a heme pigment, which causes its green color in secretions rich in neutrophils.

Human Myeloperoxidase (MPO) deficiency is a common inherited disorder linked to increased susceptibility to infection and malignancy. Human Myeloperoxidase (MPO) enzyme is expressed in the azurophilic granules of neutrophils and in the lysosomes of monocytes. Its major role is to aid in microbial killing. Human Myeloperoxidase MPO deficiency can be divided into two subgroups: primary (congenital) and secondary (acquired). Primary Human Myeloperoxidase MPO deficiency has a genetic origin, present varying degree of severity in more than one family member, and involves both the neutrophil and monocyte lineages.Human Myeloperoxidase (human MPO) REF: http://dna.uta.fi/xml/idr/FF82.xml/Myeloperoxidase
Loading...