We Are Solutions...On Demand
We Are Solutions...On Demand
Item #: 129-16
Source:
E. coli
Form:
Lyophilized in ammonium bicarbonate
Purity:
> 80 percent
Cat. No:
129-16
Storage:
-20 C
Lee Biosolutions will aliquote to your specifications.
Sequence:
GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSCCFGRKMDRISSSSGLGCKVLRRHM
108 amino acid for the full length ProBNP and 3 additional amino acids (underlined) introduced as part of the expression system.
BNP (B-type Natriuretic Peptide) is a 29 amino acid hormone released from the ventricles and acting as an arterial vasodilator and a renin inhibitor. It is a new class of cardiac marker specifically indicating congestive heart failure (CHF). Measurement of plasma levels is particularly useful as a marker of left ventricular failure (LVF).The 39 amino acid prohormone Pro-BNP offered here, is claimed to be a more sensitive marker showing a greater and faster plasma rise than BNP itself following LV
Lee Biosolutions, Inc specializes in the development and purification of high quality BioMarkers for the Immunodiagnostic, clinical diagnostic and pharmaceutical industry worldwide.
