Lee BioSolutions
P: 314-968-1091 E: order@leebio.com
Help: info@leebio.com

Eosinophil Cationic Protein (ECP)

Catalogue Number: 342-50
Description
Product Name Eosinophil Cationic Protein
Source Human Eosinophils
Catalogue Number 342-50
Purity > 80% (SDS-PAGE)
Form Liquid
Protein Conc 0.1 - 1.0 mg/mL (BCA)
Form 0.2 micron filtered solution in 50 mM sodium acetate, 200 mM sodium chloride, pH 4.7.
Appearance Clear, colorless liquid
Recertification 3 years
Storage -20°C
Synonyms ECP, Ribonuclease 3, RNase 3
Molecular Weight 18-22kDa (3 glycosolated forms exists)
UNSPSC code 51131907
E.C. Number 3.1.27.-
Gene RNASE3, ECP, RNS3
Accession No P12724
Overview

Lee Biosolutions is the leading supplier of human Eosinophil Cationic Protein (ECP) for research and diagnostic manufacturing purposes.

Custom preparations, technical support, bulk quantities and aliquoting available, email Info@leebio.com for more details.

Sequence: RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Human Eosinophil degranulation in airway tissues is thought to make significant contributions to the pathogenesis of asthma, nasal polyposis, allergic rhinitis, and eosinophilic pneumonia.

It also alters pulmonary surfactant structure and function in asthma and the proteins are critical in the pathogenesis of tropical pulmonary eosinophilia (TPE).

Human Eosinophils are also associated with other diseases of the respiratory tract. Respiratory syncytial virus (RSV) is an important respiratory pathogens worldwide. Infection is often implicated in exacerbation of asthma in children.

Order
SKU PRICE (USD) UNIT QTY
342-50-25 $ 895.00 25 ug
Gel Scan of Eosinophil Cationic Protein (ECP)