Lee BioSolutions
P: 314-968-1091 E: order@leebio.com
Help: info@leebio.com

Eosinophil Cationic Protein (ECP)

Catalogue Number: 342-50
Availability: In Stock

Description

Product Name Eosinophil Cationic Protein
Source Human Eosinophils
Catalogue Number 342-50
Purity > 80% (SDS-PAGE)
Form Liquid
Protein Conc 0.1 - 1.0 mg/mL (BCA)
Form Liquid in ammonium acetate, sodium chloride with sodium azide.
Appearance Clear, colorless liquid
Recertification 1 year
Storage -20°C
Synonyms ECP, Ribonuclease 3, RNase 3
Molecular Weight 18-22kDa (3 glycosolated forms exists)
UNSPSC code 51131907
E.C. Number 3.1.27.-
Gene RNASE3, ECP, RNS3
Accession No P12724
SKUPRICEUNITQTY
342-50-25 $ 895.00 25 ug
Bulk Quotation?
Purchase Order?

Lee Biosolutions is the leading supplier of human Eosinophil Cationic Protein (ECP) for research and diagnostic manufacturing purposes.

Custom preparations, technical support, bulk quantities and aliquoting available, email Info@leebio.com for more details.

Sequence: RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Human Eosinophil degranulation in airway tissues is thought to make significant contributions to the pathogenesis of asthma, nasal polyposis, allergic rhinitis, and eosinophilic pneumonia.

It also alters pulmonary surfactant structure and function in asthma and the proteins are critical in the pathogenesis of tropical pulmonary eosinophilia (TPE).

Human Eosinophils are also associated with other diseases of the respiratory tract. Respiratory syncytial virus (RSV) is an important respiratory pathogens worldwide. Infection is often implicated in exacerbation of asthma in children.

Diagnostic Controls, Calibrators & Standards

Immunoassays

Clinical Chemistry

Testing/Assay Validation

Life Science

ELISA, Blotting, Etc.

Validation Studies

Manufacturing