NT-Pro Brain Natriuretic Peptide (NT-ProBNP)

Catalogue Number: 129-15
Description
Product Name NT-Pro Brain Natriuretic Peptide
Source Recombinant
Catalogue Number 129-15
Purity > 95% (Electrophoresis)
Form Lyophilized
Expression System E.coli
Sequence Human sequence, 1 - 76 amino acids
Protein Reported in mg/vial
Appearance White powder
Formulation Lyophilized from ammonium acetate, pH 7.0. May contain traces of buffer salts.
Related Products 550-21 - Troponin T antigen from human heart
431-11 - Myoglobin antigen from human heart
426-10 - Myeloperoxidase antigen from human leukocytes
Storage -20°C
Recertification 5 years
Synonyms NT-ProBNP
Molecular Weight 8,400
Overview

Lee Biosolutions is a leading supplier of recombinant NT-Pro Brain Natriuretic Peptide (NT-ProBNP) for research and diagnostic manufacturing.

76 amino acids - APLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

Custom preparations, technical support, bulk quantities and aliquoting available, email Info@leebio.com for more details.

Tests showing elevated levels of BNP or NT-proBNP in the blood are used as a diagnosis of heart failure and may be useful to establish prognosis in heart failure, as both markers are typically higher in patients with worse outcome.

Both BNP and N-terminal pro-B-type natriuretic peptide have been approved as a marker for acute congestive heart failure (CHF). The plasma concentrations of both BNP are increased in patients with asymptomatic and symptomatic left ventricular dysfunction.

Add to Cart
SKU PRICE (USD) UNIT QTY
129-15-0.5 $ 1,874.00 500 ug
129-15-1 Inquire 1 mg